What is the catalog number for PYGM Peptide - C-terminal region?

The catalog number for PYGM Peptide - C-terminal region is orb2001556.

What sizes are available for PYGM Peptide - C-terminal region?

PYGM Peptide - C-terminal region is available in the following size(s): 100 µg.

Is PYGM Peptide - C-terminal region in stock?

PYGM Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

PYGM Peptide - C-terminal region

Product Specifications

UniProt

P11217

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001158188.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ANVEMAEEAGEENFFIFGMRVEDVDKLDQRGYNAQEYYDRIPELRQVIEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSW-01008-01 10 mg

A2[3]G1F1 (α-1-3) glycan

Sign In for Pricing

View Details

TSW-01008-02 50 mg

A2[3]G1F1 (α-1-3) glycan

Sign In for Pricing

View Details

21329016 1.0 µg DNA

Gata3 ORF Vector (Rat) (pORF)

Sign In for Pricing

View Details

GWB-CA3CFC 0.05 mL

Microtubule-associated Protein 1b (MAP1B) Mouse anti-Bovine Monoclonal (3G5) Antibody

Sign In for Pricing

View Details

C0510 1 mg

Cyanine 5.5 monosuccinimidyl ester, potassium salt

Sign In for Pricing

View Details

orb3149344-01 50 µg

Recombinant Mouse CD71/TFRC Protein, C-Fc

Sign In for Pricing

View Details