Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDCD6IP Peptide - C-terminal region

PDCD6IP Peptide - C-terminal region

Product Specifications

Product Name Alternative

AIP1, ALIX, HP95, DRIP4

UniProt

Q8WUM4

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001155901.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QMPMPMGYNPYAYGQYNMPYPPVYHQSPGQAPYPGPQQPSYPFPQPPQQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD134 (h.TNFRSF4, TXGP1L, ACT35, OX40, OX40L receptor, OX40 antigen, ACT35 antigen, Lymphoid activation antigen ACT35, TAX transcriptionally-activated glycoprotein 1 receptor, Tumor necrosis factor receptor superfamily member 4)
144646 100 µg

CD134 (h.TNFRSF4, TXGP1L, ACT35, OX40, OX40L receptor, OX40 antigen, ACT35 antigen, Lymphoid activation antigen ACT35, TAX transcriptionally-activated glycoprotein 1 receptor, Tumor necrosis factor receptor superfamily member 4)

Sign In for Pricing
View Details
Human PTPN11 Antibody : FITC (Phospho-Tyr580)
OAAQ00088-100T 100 Tests

Human PTPN11 Antibody : FITC (Phospho-Tyr580)

Sign In for Pricing
View Details
Hebp1-set siRNA/shRNA/RNAi Lentivector (Rat)
23168096 4x 500 ng

Hebp1-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Monkey Inosine Triphosphatase ELISA Kit
MBS047864-01 48 Well

Monkey Inosine Triphosphatase ELISA Kit

Sign In for Pricing
View Details
Monkey Inosine Triphosphatase ELISA Kit
MBS047864-02 96 Well

Monkey Inosine Triphosphatase ELISA Kit

Sign In for Pricing
View Details
Monkey Inosine Triphosphatase ELISA Kit
MBS047864-03 5x 96 Well

Monkey Inosine Triphosphatase ELISA Kit

Sign In for Pricing
View Details