What is the catalog number for ALG8 Peptide - middle region?

The catalog number for ALG8 Peptide - middle region is orb2001347.

What sizes are available for ALG8 Peptide - middle region?

ALG8 Peptide - middle region is available in the following size(s): 100 µg.

Is ALG8 Peptide - middle region in stock?

ALG8 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

ALG8 Peptide - middle region

Product Specifications

Product Name Alternative

CDG1H

UniProt

Q9BVK2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001007028.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KHIYLYVAPAYGVYLLRSYCFTANKPDGSIRWKSFSFVRVISLGLVVFLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Z100515 10 µg

Recombinant Human IL3

Sign In for Pricing

View Details

RM-I210680-01 10 mg

Ibuprofen Impurity 56

Sign In for Pricing

View Details

RM-I210680-02 25 mg

Ibuprofen Impurity 56

Sign In for Pricing

View Details

RM-I210680-03 50 mg

Ibuprofen Impurity 56

Sign In for Pricing

View Details

RM-I210680-04 100 mg

Ibuprofen Impurity 56

Sign In for Pricing

View Details

E-AB-F1227UM1-01 25 µg

Elab Fluor® 700 Anti-Rat CD45 Antibody[OX-1]

Sign In for Pricing

View Details