Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP2A7 Peptide - N-terminal region

CYP2A7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CPA7, CPAD, CYP2A, CYPIIA7, P450-IIA4

UniProt

Q16696

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CYP2A7 Rabbit Polyclonal Antibody (orb55752) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000755.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLNTEHICDSI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AICAR 3’,5’-Cyclic Phosphate
TRC-A440500-25MG 25 mg

AICAR 3’,5’-Cyclic Phosphate

Sign In for Pricing
View Details
PRADC1 Human Gene Knockout Kit (CRISPR)
KN402972 1 Kit

PRADC1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
3mC Recombinant Rabbit Monoclonal Antibody [PSH03-22]
HA721958 100 µL

3mC Recombinant Rabbit Monoclonal Antibody [PSH03-22]

Sign In for Pricing
View Details
ERK1 (MAPK3) pThr202 Rabbit Polyclonal Antibody
AP02498PU-S 50 µL

ERK1 (MAPK3) pThr202 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant ALDH7A1 Antibody
RC-4282-01 50 μL

Recombinant ALDH7A1 Antibody

Sign In for Pricing
View Details
Recombinant ALDH7A1 Antibody
RC-4282-02 100 µL

Recombinant ALDH7A1 Antibody

Sign In for Pricing
View Details