Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINB9 Peptide - C-terminal region

SERPINB9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PI9, CAP3, PI-9, CAP-3

UniProt

P50453

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SERPINB9 Rabbit Polyclonal Antibody (orb331023) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004146

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHOP, phosphorylated (Ser30) discontinued
534703-01 30ul

CHOP, phosphorylated (Ser30) discontinued

Sign In for Pricing
View Details
CHOP, phosphorylated (Ser30) discontinued
534703-02 100 µL

CHOP, phosphorylated (Ser30) discontinued

Sign In for Pricing
View Details
F204A Rabbit Polyclonal Antibody
BT-AP02539-01 20 µL

F204A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
F204A Rabbit Polyclonal Antibody
BT-AP02539-02 50 µL

F204A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
F204A Rabbit Polyclonal Antibody
BT-AP02539-03 100 µL

F204A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CXCL5 Recombinant Protein (Human)
OPCA00629-1MG 1 mg

CXCL5 Recombinant Protein (Human)

Sign In for Pricing
View Details