What is the catalog number for CXCL5 Recombinant Protein (Human)?

The catalog number for CXCL5 Recombinant Protein (Human) is OPCA00629-1MG.

What sizes are available for CXCL5 Recombinant Protein (Human)?

CXCL5 Recombinant Protein (Human) is available in the following size(s): 1 mg.

Is CXCL5 Recombinant Protein (Human) in stock?

CXCL5 Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

CXCL5 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

C-X-C motif chemokine ligand 5

Gene Aliases

Chemokine (C-X-C motif) ligand 5; C-X-C motif chemokine 5; ENA-78; ENA-78 (1-78) ; epithelial-derived neutrophil-activating protein 78; neutrophil-activating peptide ENA-78; neutrophil-activating protein 78; SCYB5; small inducible cytokine subfamily B (Cys-X-Cys), member 5 (epithelial-derived neutrophil-activating peptide 78) ; Small-inducible cytokine B5.

Gene ID

6374

Reactivity

Homo sapiens|Human

Target

Involved in neutrophil activation. In vitro, ENA-78 (8-78) and ENA-78 (9-78) show a threefold higher chemotactic activity for neutrophil granulocytes.

Type

Protein

Source

E.coli

Sequence

AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.