GIT1 Peptide - middle region
GIT1 Peptide - middle region
Product Specifications
UniProt
Q9Y2X7
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GIT1 Rabbit Polyclonal Antibody (orb588117) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001078923.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QEGSRHTSKLSRHGSGADSDYENTQSGDPLLGLEGKRFLELGKEEDFHPE
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15319740 1 Vial
Lentiviral human NPRL3 shRNA (UAS) - Lentiviral human NPRL3 shRNA (UAS, GFP) (100)
Sign In for Pricing
View Details 
FY-EH3114S 96 Well
Easypro Human Small Nuclear Ribonucleoprotein D1 (SNRPD1) ELISA Kit
Sign In for Pricing
View Details 36433066 1.0 µg DNA
PFKFB4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details