HOXB2 Peptide - middle region
HOXB2 Peptide - middle region
Product Specifications
Product Name Alternative
K8, HOX2, HOX2H, Hox-2.8
UniProt
P14652
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HOXB2 Rabbit Polyclonal Antibody (orb588278) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002136.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QVKVWFQNRRMKHKRQTQHREPPDGEPACPGALEDICDPAEEPAASPGGP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TA373241 100 µL
Activin Receptor Type IIA (ACVR2A) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
LY420930 100 µg
CARHSP1 (NM_001042476) Human Over-expression Lysate
Sign In for Pricing
View Details 
![BLCAP Mouse Monoclonal Antibody [4E1]](https://cdn.genprice.uk/products/992/68dd1c8e061270361ea8248e/imageurl/m1701-10.webp)
![eIF1A Recombinant Rabbit Monoclonal Antibody [JE64-63]](https://cdn.genprice.uk/products/992/68dd1c8b061270361ea81852/imageurl/ha721099.webp)
HA721099 100 µL
eIF1A Recombinant Rabbit Monoclonal Antibody [JE64-63]
Sign In for Pricing
View Details 