Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTO1 Peptide - C-terminal region

MTO1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CGI-02, COXPD10

UniProt

Q9Y2Z2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTO1 Rabbit Polyclonal Antibody (orb588305) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001116698.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HFSRPQTIGAASRIPGVTPAAIINLLRFVKTTQRRQSAMNESSKTDQYLC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMURF1 Rabbit Polyclonal Antibody
HA500057 100 µL

SMURF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human CSNK1G1 activation kit by CRISPRa
GA110046 1 Kit

Human CSNK1G1 activation kit by CRISPRa

Sign In for Pricing
View Details
HRP Conjugated Morniga G Lectin (black mulberry) -MNA-G-
H-9005-1 1 mg

HRP Conjugated Morniga G Lectin (black mulberry) -MNA-G-

Sign In for Pricing
View Details
(R)-alpha-[[(4-Ethyl-2,3-dioxo-1-piperazinyl)carbonyl]amino]benzeneacetic Acid
TRC-E916970-1G 1 g

(R)-alpha-[[(4-Ethyl-2,3-dioxo-1-piperazinyl)carbonyl]amino]benzeneacetic Acid

Sign In for Pricing
View Details
Frozen Tissue Blocks, Colon: sigmoid
CB524212 1 Block

Frozen Tissue Blocks, Colon: sigmoid

Sign In for Pricing
View Details
5-Aminoimidazole-4-carboxamide-1-Beta-D-ribofuranoside-13C2,15N
TRC-A611702-5MG 5 mg

5-Aminoimidazole-4-carboxamide-1-Beta-D-ribofuranoside-13C2,15N

Sign In for Pricing
View Details