Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPTN Peptide - C-terminal region

NPTN Peptide - C-terminal region

Product Specifications

Product Name Alternative

GP55, GP65, SDR1, np55, np65, SDFR1

UniProt

Q9Y639

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NPTN Rabbit Polyclonal Antibody (orb588311) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001154835.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AEIIILVVIIVVYEKRKRPDEVPDDDEPAGPMKTNSTNNHKDKNLRQRNT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Haus4 shRNA (UAS) - Lentiviral mouse Haus4 shRNA (UAS, RFP) (100)
GTR15119856 1 Vial

Lentiviral mouse Haus4 shRNA (UAS) - Lentiviral mouse Haus4 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
SLC46A3 HDR Plasmid (m)
sc-428013-HDR 20 µg

SLC46A3 HDR Plasmid (m)

Sign In for Pricing
View Details
Nckap5 Mouse shRNA Plasmid (Locus ID 210356)
TL514185 1 Kit

Nckap5 Mouse shRNA Plasmid (Locus ID 210356)

Sign In for Pricing
View Details
Mouse Monoclonal CD34 Antibody (QBEnd10) [DyLight 488]
FAB7227K 0.1 mL

Mouse Monoclonal CD34 Antibody (QBEnd10) [DyLight 488]

Sign In for Pricing
View Details
Rat Anti-Mouse CD2/LFA-2-LE/AF
MBS673127-01 0.5 mg

Rat Anti-Mouse CD2/LFA-2-LE/AF

Sign In for Pricing
View Details
Rat Anti-Mouse CD2/LFA-2-LE/AF
MBS673127-02 5x 0.5 mg

Rat Anti-Mouse CD2/LFA-2-LE/AF

Sign In for Pricing
View Details