Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHB Peptide - middle region

PHB Peptide - middle region

Product Specifications

Product Name Alternative

PHB1, HEL-215, HEL-S-54e

UniProt

P35232

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PHB Rabbit Polyclonal Antibody (orb588334) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001268425.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-PRKAA1 (Thr183) Antibody Blocking Peptide
orb257083 500 µg

Phospho-PRKAA1 (Thr183) Antibody Blocking Peptide

Sign In for Pricing
View Details
EIF4E Rabbit Monoclonal antibody
AMRe01941-01 1 Each

EIF4E Rabbit Monoclonal antibody

Sign In for Pricing
View Details
EIF4E Rabbit Monoclonal antibody
AMRe01941-02 50 µL

EIF4E Rabbit Monoclonal antibody

Sign In for Pricing
View Details
EIF4E Rabbit Monoclonal antibody
AMRe01941-03 100 µL

EIF4E Rabbit Monoclonal antibody

Sign In for Pricing
View Details
Deep Red Fluorescent Rapid Labeling Kit (CY5)
HY-KD1107-01 200 µg

Deep Red Fluorescent Rapid Labeling Kit (CY5)

Sign In for Pricing
View Details
Deep Red Fluorescent Rapid Labeling Kit (CY5)
HY-KD1107-02 1 mg

Deep Red Fluorescent Rapid Labeling Kit (CY5)

Sign In for Pricing
View Details