Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDLIM7 Peptide - middle region

PDLIM7 Peptide - middle region

Product Specifications

Product Name Alternative

LMP1, LMP3

UniProt

Q9NR12

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDLIM7 Rabbit Polyclonal Antibody (orb588726) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005442.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KKSSQVPRTEAPAPASSTPQEPWPGPTAPSPTSRPPWAVDPAFAERYAPD

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,5-Diethoxy-4- (morpholin-4-yl) aniline dihydrochloride
OR60195 1 Each

2,5-Diethoxy-4- (morpholin-4-yl) aniline dihydrochloride

Sign In for Pricing
View Details
MRPL23 Antibody - C-terminal region : FITC (ARP74071_P050-FITC)
ARP74071_P050-FITC 100 µL

MRPL23 Antibody - C-terminal region : FITC (ARP74071_P050-FITC)

Sign In for Pricing
View Details
ReadiPrep™ Ni-TED Magnetic Agarose Beads
V105110-AAT 1 mL

ReadiPrep™ Ni-TED Magnetic Agarose Beads

Sign In for Pricing
View Details
Recombinant human PSMA8 protein
ATGP1320-010 10 µg

Recombinant human PSMA8 protein

Sign In for Pricing
View Details
CD57 shRNA Plasmid (m)
sc-60690-SH 20 µg

CD57 shRNA Plasmid (m)

Sign In for Pricing
View Details
Active N-Terminal Pro-Brain Natriuretic Peptide (NT-ProBNP)
TRV-0001688-01 10 µg

Active N-Terminal Pro-Brain Natriuretic Peptide (NT-ProBNP)

Sign In for Pricing
View Details