Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OPRPN Peptide - N-terminal region

OPRPN Peptide - N-terminal region

Product Specifications

Product Name Alternative

BPLP, PRL1, PROL1, opiorphin

UniProt

P21730

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OPRPN Rabbit Polyclonal Antibody (orb588868) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001727.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Interleukin 18 (IL-18) ELISA Kit
NSL0461Bo 96 Tests

Bovine Interleukin 18 (IL-18) ELISA Kit

Sign In for Pricing
View Details
SF3B3 Antibody - C-terminal region (ARP74214_P050)
ARP74214_P050 100 µL

SF3B3 Antibody - C-terminal region (ARP74214_P050)

Sign In for Pricing
View Details
EDD (D-5)
sc-515423 200 µg/mL

EDD (D-5)

Sign In for Pricing
View Details
Guanabenz (hydrochloride) (Standard)
HY-12724AR-01 5 mg

Guanabenz (hydrochloride) (Standard)

Sign In for Pricing
View Details
Guanabenz (hydrochloride) (Standard)
HY-12724AR-02 10 mg

Guanabenz (hydrochloride) (Standard)

Sign In for Pricing
View Details
Guanabenz (hydrochloride) (Standard)
HY-12724AR-03 25 mg

Guanabenz (hydrochloride) (Standard)

Sign In for Pricing
View Details