Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLIPR2 Peptide - middle region

GLIPR2 Peptide - middle region

Product Specifications

Product Name Alternative

GAPR1, GAPR-1, C9orf19

UniProt

Q9H4G4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GLIPR2 Rabbit Polyclonal Antibody (orb589177) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071738.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PESSRGQCGENLAWASYDQTGKEVADRWYSEIKNYNFQQPGFTSGTGHFT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rhombotin-1 (LMO1) Bovine ELISA Kit
G7767 96 Tests

Rhombotin-1 (LMO1) Bovine ELISA Kit

Sign In for Pricing
View Details
Human CD3 Mouse Monoclonal Antibody (PE)
orb525871-01 25 Tests

Human CD3 Mouse Monoclonal Antibody (PE)

Sign In for Pricing
View Details
Human CD3 Mouse Monoclonal Antibody (PE)
orb525871-02 50 Tests

Human CD3 Mouse Monoclonal Antibody (PE)

Sign In for Pricing
View Details
Human CD3 Mouse Monoclonal Antibody (PE)
orb525871-03 100 Tests

Human CD3 Mouse Monoclonal Antibody (PE)

Sign In for Pricing
View Details
Bis-PEG23-endo-BCN
orb1988610 2 mg

Bis-PEG23-endo-BCN

Sign In for Pricing
View Details
Triphenylphosphate-d15 100ug/mL in Isooctane - 1ML
REPBDE0519 1 mL

Triphenylphosphate-d15 100ug/mL in Isooctane - 1ML

Sign In for Pricing
View Details