GLIPR2 Peptide - middle region
GLIPR2 Peptide - middle region
Product Specifications
Product Name Alternative
GAPR1, GAPR-1, C9orf19
UniProt
Q9H4G4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GLIPR2 Rabbit Polyclonal Antibody (orb589177) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_071738.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PESSRGQCGENLAWASYDQTGKEVADRWYSEIKNYNFQQPGFTSGTGHFT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Anti-CD40 [FGK45]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
V5614-20UG 20 µg
Recombinant CDX2 Antibody / Caudal-type homeobox protein 2
Sign In for Pricing
View Details MBS1283458-01 0.02 mg (E-Coli)
Recombinant Shewanella oneidensis D-tyrosyl-tRNA (Tyr) deacylase (dtd)
Sign In for Pricing
View Details