TRMT12 Peptide - middle region
TRMT12 Peptide - middle region
Product Specifications
Product Name Alternative
TYW2, TRM12
UniProt
Q53H54
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TRMT12 Rabbit Polyclonal Antibody (orb589018) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060426.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KEHWLYPQQITTNQWKNGATRDSRGKMLSPATKPEWQRWAESAETRIATL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
350427-01 50 µL
ERVK-7, CT (Endogenous retrovirus group K member 7 Env polyprotein, Envelope polyprotein, HERV-K (III) envelope protein, HERV-K102 envelope protein, HERV-K_1q22 provirus ancestral Env polyprotein, Surface protein, SU, Transmembrane protein, TM)
Sign In for Pricing
View Details 350427-02 200 µL
ERVK-7, CT (Endogenous retrovirus group K member 7 Env polyprotein, Envelope polyprotein, HERV-K (III) envelope protein, HERV-K102 envelope protein, HERV-K_1q22 provirus ancestral Env polyprotein, Surface protein, SU, Transmembrane protein, TM)
Sign In for Pricing
View Details 
MBS1179956-01 0.02 mg (E-Coli)
Recombinant Vibrio harveyi Phosphate acyltransferase (plsX)
Sign In for Pricing
View Details MBS1179956-02 0.02 mg (Yeast)
Recombinant Vibrio harveyi Phosphate acyltransferase (plsX)
Sign In for Pricing
View Details