Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF3I Rabbit Polyclonal Antibody (HRP)

EIF3I Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TRIP1, EIF3S2, TRIP-1, PRO2242, eIF3-p36, eIF3-beta

UniProt

Q13347

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RDPSQIDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003748

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX47 antibody
70R-1369 100 µL

DDX47 antibody

Sign In for Pricing
View Details
P53 Ser15 Rabbit Polyclonal Antibody
E53P05499 100 µL

P53 Ser15 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cre-IRES-mCherry lentivirus (UBC, Puro) - Cre-IRES-mCherry lentivirus (UBC, Puro)
GTR15424581 25 µL (1x 25 µL)

Cre-IRES-mCherry lentivirus (UBC, Puro) - Cre-IRES-mCherry lentivirus (UBC, Puro)

Sign In for Pricing
View Details
TSPAN6, CT (TSPAN6, TM4SF6, Tetraspanin-6, A15 homolog, Putative NF-kappa-B-activating protein 321, T245 protein, Tetraspanin TM4-D, Transmembrane 4 superfamily member 6) (FITC) discontinued
043383-FITC 200 µL

TSPAN6, CT (TSPAN6, TM4SF6, Tetraspanin-6, A15 homolog, Putative NF-kappa-B-activating protein 321, T245 protein, Tetraspanin TM4-D, Transmembrane 4 superfamily member 6) (FITC) discontinued

Sign In for Pricing
View Details
SULT1A1, ID (Sulfotransferase 1A1, ST1A1 , Aryl Sulfotransferase 1, Phenol Sulfotransferase 1, Phenol-sulfating Phenol Sulfotransferase 1, P-PST 1, Thermostable Phenol Sulfotransferase, Ts-PST, HAST1/HAST2, ST1A3, STP, STP1, OK/SW-cl.88) (MaxLight 490) discontinued
S8022-03A-ML490 100 µL

SULT1A1, ID (Sulfotransferase 1A1, ST1A1 , Aryl Sulfotransferase 1, Phenol Sulfotransferase 1, Phenol-sulfating Phenol Sulfotransferase 1, P-PST 1, Thermostable Phenol Sulfotransferase, Ts-PST, HAST1/HAST2, ST1A3, STP, STP1, OK/SW-cl.88) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Nalgene Bottle 500mlx28mm PE NM
BOT0056 12 / PCK

Nalgene Bottle 500mlx28mm PE NM

Sign In for Pricing
View Details