Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRMT10A Peptide - middle region

TRMT10A Peptide - middle region

Product Specifications

Product Name Alternative

MSSGM, TRM10, RG9MTD2, HEL-S-88

UniProt

X6REK4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRMT10A Rabbit Polyclonal Antibody (orb55785) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001128137.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IKQKQWEEQRELRKQKRKEKRKRKKLERQCQMEPNSDGHDRKRVRRDVVH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant human CIB1 protein
CIB0801-100 100 µg

Recombinant human CIB1 protein

Sign In for Pricing
View Details
Anti-PGRMC2 Rabbit pAb
GB114778-50 50 μL

Anti-PGRMC2 Rabbit pAb

Sign In for Pricing
View Details
TMEM267 (NM_022483) Human 3' UTR Clone
SC217252 10 µg

TMEM267 (NM_022483) Human 3' UTR Clone

Sign In for Pricing
View Details
FUZ/FUZZY Rabbit Polyclonal Antibody (APC)
orb996332 100 µL

FUZ/FUZZY Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
CD61 (Glycoprotein IIIa, Integrin beta3) (MaxLight 490)
MBS6245347-01 0.1 mL

CD61 (Glycoprotein IIIa, Integrin beta3) (MaxLight 490)

Sign In for Pricing
View Details
CD61 (Glycoprotein IIIa, Integrin beta3) (MaxLight 490)
MBS6245347-02 5x 0.1 mL

CD61 (Glycoprotein IIIa, Integrin beta3) (MaxLight 490)

Sign In for Pricing
View Details