Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISLR Peptide - middle region

ISLR Peptide - middle region

Product Specifications

UniProt

O14498

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ISLR Rabbit Polyclonal Antibody (orb589107) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005536.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EGTYSCLATNELGSAESSVDVALATPGEGGEDTLGRRFHGKAVEGKGCYT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPM-WASTE-300MMX30M-BK/GN/BK-ROLL Pipe Markers for Other Liquids
310447 1 Pack (1 Roll x 1 Roll)

MPM-WASTE-300MMX30M-BK/GN/BK-ROLL Pipe Markers for Other Liquids

Sign In for Pricing
View Details
Human SLC5A11 knockdown cell line
ABC-KD14156 1 Vial

Human SLC5A11 knockdown cell line

Sign In for Pricing
View Details
CD38 Recombinant Protein
11-441 0.1 mg

CD38 Recombinant Protein

Sign In for Pricing
View Details
7’-Hydroxy-N-Trityl-morpholino guanine
NT184333-01 0.5 g

7’-Hydroxy-N-Trityl-morpholino guanine

Sign In for Pricing
View Details
7’-Hydroxy-N-Trityl-morpholino guanine
NT184333-02 1 g

7’-Hydroxy-N-Trityl-morpholino guanine

Sign In for Pricing
View Details
AM095 free base 200mg
A14180-200 200 mg

AM095 free base 200mg

Sign In for Pricing
View Details