Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BSND Peptide - middle region

BSND Peptide - middle region

Product Specifications

Product Name Alternative

BART, DFNB73

UniProt

Q8WZ55

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BSND Rabbit Polyclonal Antibody (orb584384) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_476517

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tg ORF Vector (Mouse) (pORF)
ORF059473 1.0 µg DNA

Tg ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
SBDS, Mouse (His)
HY-P76049-01 5 µg

SBDS, Mouse (His)

Sign In for Pricing
View Details
SBDS, Mouse (His)
HY-P76049-02 10 µg

SBDS, Mouse (His)

Sign In for Pricing
View Details
SBDS, Mouse (His)
HY-P76049-03 50 µg

SBDS, Mouse (His)

Sign In for Pricing
View Details
SBDS, Mouse (His)
HY-P76049-04 100 µg

SBDS, Mouse (His)

Sign In for Pricing
View Details
MRPL34 Antibody
A40739-50UG 50 µg

MRPL34 Antibody

Sign In for Pricing
View Details