Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SBDS, Mouse (His)

SBDS proteins are essential for the assembly of mature ribosomes and ribosome biogenesis. It cooperates with EFL1 to catalyze the GTP-dependent release of EIF6 from 60S preribosomes in the cytoplasm, activating the translation ability of ribosomes. SBDS Protein, Mouse (His) is the recombinant mouse-derived SBDS protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

SBDS Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sbds-protein-mouse-his.html

Purity

98.0

Smiles

MSIFTPTNQIRLTNVAVVRMKRGGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKPNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLMKVVESEDYSQQLEIVCLIDPGCFREIDELIKKETKGRGSLEVLSLKDVEEGDEKFE

Molecular Formula

66711 (Gene_ID) P70122 (M1-E250) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VGF Nerve Growth Factor Inducible (VGF) Antibody
abx178876-01 200 µg

VGF Nerve Growth Factor Inducible (VGF) Antibody

Sign In for Pricing
View Details
VGF Nerve Growth Factor Inducible (VGF) Antibody
abx178876-02 1 mg

VGF Nerve Growth Factor Inducible (VGF) Antibody

Sign In for Pricing
View Details
Anti-Gbp4 Antibody Picoband®, APC Conjugate
A11011-3-APC 100 µg/Vial

Anti-Gbp4 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
ZSWIM2 CRISPRa sgRNA lentivector (set of three targets)(Rat)
51982126 3x 1.0µg DNA

ZSWIM2 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
ADAL, CT (ADAL, Adenosine deaminase-like protein) (PE)
MBS6271485-01 0.2 mL

ADAL, CT (ADAL, Adenosine deaminase-like protein) (PE)

Sign In for Pricing
View Details
ADAL, CT (ADAL, Adenosine deaminase-like protein) (PE)
MBS6271485-02 5x 0.2 mL

ADAL, CT (ADAL, Adenosine deaminase-like protein) (PE)

Sign In for Pricing
View Details