Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK36 Peptide - middle region

STK36 Peptide - middle region

Product Specifications

Product Name Alternative

FU

UniProt

H7C2I3

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STK36 Rabbit Polyclonal Antibody (orb589160) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001230242.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PRENRTTPDCERAFPEERPEVLGQRSTDVVDLENEEPDSDNEWQHLLETT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ALAS2 qPCR Primer Pair
QH10121S 200 Tests

Human ALAS2 qPCR Primer Pair

Sign In for Pricing
View Details
IDE Rabbit Monoclonal Antibody
orb2989304-01 30 µL

IDE Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
IDE Rabbit Monoclonal Antibody
orb2989304-02 50 µL

IDE Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
IDE Rabbit Monoclonal Antibody
orb2989304-03 100 µL

IDE Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
IDE Rabbit Monoclonal Antibody
orb2989304-04 200 µL

IDE Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
KGF/FGF-7, Human (CHO)
HY-P7047A-01 2 µg

KGF/FGF-7, Human (CHO)

Sign In for Pricing
View Details