Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KGF/FGF-7, Human (CHO)

KGF/FGF-7 Protein, Human (CHO) is a polypeptide mitogen that belongs to the family of fibroblast growth factors, binds only to a splice variant of FGFR2 (FGFR2 IIIb) and is a highly specific paracrine growth factor for epithelial cells. KGF/FGF-7 Protein and its receptor are important for normal wound healing.

Product Specifications

Product Name Alternative

KGF/FGF-7 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/kgf-fgf-7-protein-human-cho.html

Purity

95.00

Smiles

CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

Molecular Formula

2252 (Gene_ID) P21781-1 (C32-T194) (Accession)

Molecular Weight

Approximately 16-27, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Trowbridge JM, et al. Dermatan sulfate binds and potentiates activity of keratinocyte growth factor (FGF-7) . J Biol Chem. 2002 Nov 8;277 (45) :42815-20.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral mouse Actr3b shRNA (UAS) - Lentiviral mouse Actr3b shRNA (UAS, iRFP) (25)
GTR15242366 1 Vial

Lentiviral mouse Actr3b shRNA (UAS) - Lentiviral mouse Actr3b shRNA (UAS, iRFP) (25)

Ask
View Details
MCAM (Cell Surface Glycoprotein MUC18, Melanoma-associated Antigen MUC18, Melanoma Cell Adhesion Molecule, Melanoma-associated Antigen A32, S-endo 1 Endothelial-associated Antigen, Cell Surface Glycoprotein P1H12, CD146, MCAM, MUC18)
M2693-26C 100 µg

MCAM (Cell Surface Glycoprotein MUC18, Melanoma-associated Antigen MUC18, Melanoma Cell Adhesion Molecule, Melanoma-associated Antigen A32, S-endo 1 Endothelial-associated Antigen, Cell Surface Glycoprotein P1H12, CD146, MCAM, MUC18)

Ask
View Details
Musculin shRNA Plasmid (m)
sc-38067-SH 20 µg

Musculin shRNA Plasmid (m)

Ask
View Details
Human HSPH1 Pre-designed siRNA Set B
SI007342B 1 Each

Human HSPH1 Pre-designed siRNA Set B

Ask
View Details