Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KGF/FGF-7, Human (CHO)

KGF/FGF-7 Protein, Human (CHO) is a polypeptide mitogen that belongs to the family of fibroblast growth factors, binds only to a splice variant of FGFR2 (FGFR2 IIIb) and is a highly specific paracrine growth factor for epithelial cells. KGF/FGF-7 Protein and its receptor are important for normal wound healing.

Product Specifications

Product Name Alternative

KGF/FGF-7 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/kgf-fgf-7-protein-human-cho.html

Purity

95.00

Smiles

CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

Molecular Formula

2252 (Gene_ID) P21781-1 (C32-T194) (Accession)

Molecular Weight

Approximately 16-27, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Trowbridge JM, et al. Dermatan sulfate binds and potentiates activity of keratinocyte growth factor (FGF-7) . J Biol Chem. 2002 Nov 8;277 (45) :42815-20.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

BIRC7 (Baculoviral IAP Repeat-containing Protein 7, KIAP, LIVIN, MLIAP, RNF50, ML-IAP) discontinued
209769-01 20 µL

BIRC7 (Baculoviral IAP Repeat-containing Protein 7, KIAP, LIVIN, MLIAP, RNF50, ML-IAP) discontinued

Ask
View Details
BIRC7 (Baculoviral IAP Repeat-containing Protein 7, KIAP, LIVIN, MLIAP, RNF50, ML-IAP) discontinued
209769-02 100 µL

BIRC7 (Baculoviral IAP Repeat-containing Protein 7, KIAP, LIVIN, MLIAP, RNF50, ML-IAP) discontinued

Ask
View Details
Lentiviral human REEP3 sgRNA gene knockout kit - Lentiviral human REEP3 sgRNA gene knockout kit (25)
GTR15383565 1 Vial

Lentiviral human REEP3 sgRNA gene knockout kit - Lentiviral human REEP3 sgRNA gene knockout kit (25)

Ask
View Details
Desphenyl Chloridazon
TRC-D297000-5MG 5 mg

Desphenyl Chloridazon

Ask
View Details
Lentiviral human TTC21B sgRNA gene knockout kit - Lentiviral human TTC21B sgRNA gene knockout kit (25)
GTR15355346 1 Vial

Lentiviral human TTC21B sgRNA gene knockout kit - Lentiviral human TTC21B sgRNA gene knockout kit (25)

Ask
View Details
TAF9, NT (TAF9, TAF2G, TAFII31, Transcription initiation factor TFIID subunit 9, RNA polymerase II TBP-associated factor subunit G, STAF31/32, Transcription initiation factor TFIID 31kD subunit, Transcription initiation factor TFIID 32kD subunit) (MaxLight 650) discontinued
042586-ML650 100 µL

TAF9, NT (TAF9, TAF2G, TAFII31, Transcription initiation factor TFIID subunit 9, RNA polymerase II TBP-associated factor subunit G, STAF31/32, Transcription initiation factor TFIID 31kD subunit, Transcription initiation factor TFIID 32kD subunit) (MaxLight 650) discontinued

Ask
View Details