HSPA5 Peptide - middle region
HSPA5 Peptide - middle region
Product Specifications
Product Name Alternative
BIP, MIF2, GRP78, HEL-S-89n
UniProt
P11021
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HSPA5 Rabbit Polyclonal Antibody (orb589225) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_005338.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ARP60035_P050 100 µL
F2RL1 Antibody - C-terminal region (ARP60035_P050)
Sign In for Pricing
View Details 
131355-ML550 100 µL
PINK1 (Serine/Threonine-protein Kinase PINK1, Mitochondrial, BRPK, PTEN-induced Putative Kinase Protein 1, FLJ27236, PARK6) (MaxLight 550)
Sign In for Pricing
View Details 