Porcine TSPO protein
This Porcine TSPO protein spans the amino acid sequence from region 1-169aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Peripheral-type benzodiazepine receptor
UniProt
Q6UN27
Expression Region
1-169aa
Tag
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Source
In vitro E.coli expression system
Origin
Sus scrofa (Pig)
Field of Research
Cancer Biology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
38.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MAPPWLPAVGFTLVPSLGGFLSSRNVLGKGLHWYAGLQKPSWHPPHWTLAPIWGTLYSAMGYGSYMIWKELGGFSEEAVVPLGLYAGQLALNWAWPPLFFGARQMGWALVDLVLTGGVAAATAVAWYQVSPLAARLLYPYLAWLAFAATLNYCVWRDNQGRRGGRRPSE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC681429-500 1x 500 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401073-500 1x 500 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400676-100 1x 100 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471104-100 1x 100 µL
PAX2 (Renal Cell & Ovarian Carcinoma Marker) (PAX2/1104), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401593-500 1x 500 µL
Aurora B (Proliferation Marker) (AURKB/1593), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742078-100 1x 100 µL
TCL1 (T-Cell Marker) (TCL1/2078), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details