Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSL3 Peptide - C-terminal region

MSL3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MSL3L1

UniProt

Q8N5Y2

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MSL3 Rabbit Polyclonal Antibody (orb588474) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_523353

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: STRHSANCDRLSESSASPQPKRRQQDTSASMPKLFLHLEKKTPVHSRSSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSV-60mer (sodium)
HY-160222-01 1 mg

HSV-60mer (sodium)

Sign In for Pricing
View Details
HSV-60mer (sodium)
HY-160222-02 5 mg

HSV-60mer (sodium)

Sign In for Pricing
View Details
HSV-60mer (sodium)
HY-160222-03 10 mg

HSV-60mer (sodium)

Sign In for Pricing
View Details
Label/Dot Combo Roll, Cryo, Direct Thermal
LTC-33X13-95R 500/Box

Label/Dot Combo Roll, Cryo, Direct Thermal

Sign In for Pricing
View Details
Recombinant Human PKMYT1, catalytic domain – dephosphorylated
5756981-CDD-01 10 µg

Recombinant Human PKMYT1, catalytic domain – dephosphorylated

Sign In for Pricing
View Details
Recombinant Human PKMYT1, catalytic domain – dephosphorylated
5756981-CDD-02 50 µg

Recombinant Human PKMYT1, catalytic domain – dephosphorylated

Sign In for Pricing
View Details