SLC39A13 Peptide - middle region
SLC39A13 Peptide - middle region
Product Specifications
Product Name Alternative
LZT-Hs9
UniProt
Q96H72
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SLC39A13 Rabbit Polyclonal Antibody (orb589181) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001121697.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: WVIAGILTFLALEKMFLDSKEEGTSQAPNKDPTAAAAALNGGHCLAQPAA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP06683PU-N 100 µg
beta Catenin (CTNNB1) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
![Thyroglobulin (TG) Mouse Monoclonal Antibody [Clone ID: 2H11]](https://cdn.genprice.uk/products/937/68dd189e061270361e8fd49d/imageurl/am33242pu-t.webp)
AM33242PU-T 20 µg
Thyroglobulin (TG) Mouse Monoclonal Antibody [Clone ID: 2H11]
Sign In for Pricing
View Details 
E-BC-K149-M-01 48 T (24 samples)
Mitochondrial Complex I (NADH-CoQ Reductase) Activity Assay Kit
Sign In for Pricing
View Details E-BC-K149-M-02 96 T (48 samples)
Mitochondrial Complex I (NADH-CoQ Reductase) Activity Assay Kit
Sign In for Pricing
View Details