Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNRHR Peptide - C-terminal region

GNRHR Peptide - C-terminal region

Product Specifications

Product Name Alternative

HH7, GRHR, LRHR, LHRHR, GNRHR1

UniProt

P30968

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GNRHR Rabbit Polyclonal Antibody (orb589323) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000397.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Terminal uridylyltransferase 7 (Zcchc6) , partial
MBS1441133 Inquire

Recombinant Mouse Terminal uridylyltransferase 7 (Zcchc6) , partial

Sign In for Pricing
View Details
M-CSF human rec.
CB-1123001 10 µg

M-CSF human rec.

Sign In for Pricing
View Details
TAF6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2328506 1.0 µg DNA

TAF6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Rabbit Polyclonal TINP1 Antibody [mFluor Violet 610 SE]
NBP2-99405MFV610 0.1 mL

Rabbit Polyclonal TINP1 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Rabbit Monoclonal Histone H3 [p Thr3] Antibody (RM159) - Azide and BSA Free
NBP3-26019 100 µg

Rabbit Monoclonal Histone H3 [p Thr3] Antibody (RM159) - Azide and BSA Free

Sign In for Pricing
View Details
LGR4, Human (HEK293, His)
HY-P704120 100 µg

LGR4, Human (HEK293, His)

Sign In for Pricing
View Details