Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIST1H2BK Peptide - N-terminal region

HIST1H2BK Peptide - N-terminal region

Product Specifications

Product Name Alternative

H2B/S, H2BFAiii, H2BFT, MGC131989

UniProt

O60814

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_542160

Preservative

Lyophilized powder

AA Sequence

KKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFER

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PD-L1 Recombinant Rabbit Monoclonal Antibody [PD00-97]
HA722300 100 µL

PD-L1 Recombinant Rabbit Monoclonal Antibody [PD00-97]

Sign In for Pricing
View Details
Recombinant Human TNF-α Protein (Gst Tag)
PDEH100596-01 20 µg

Recombinant Human TNF-α Protein (Gst Tag)

Sign In for Pricing
View Details
Recombinant Human TNF-α Protein (Gst Tag)
PDEH100596-02 100 µg

Recombinant Human TNF-α Protein (Gst Tag)

Sign In for Pricing
View Details
Recombinant Human TNF-α Protein (Gst Tag)
PDEH100596-03 500 µg

Recombinant Human TNF-α Protein (Gst Tag)

Sign In for Pricing
View Details
Recombinant Human TNF-α Protein (Gst Tag)
PDEH100596-04 1 mg

Recombinant Human TNF-α Protein (Gst Tag)

Sign In for Pricing
View Details
Human CCL3 / MIP-1 alpha Recombinant Rabbit monoclonal Antibody
HA723380 100 µL

Human CCL3 / MIP-1 alpha Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details