Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kctd3 Peptide - middle region

Kctd3 Peptide - middle region

Product Specifications

Product Name Alternative

4930438A20Rik, 9330185B06, E330032J19Rik, NY-REN-45

UniProt

Q8BFX3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Kctd3 Rabbit Polyclonal Antibody (orb575421) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766238

Preservative

Lyophilized powder

AA Sequence

MKDNDLLVTELYHDPSNDAVTALSVYLTPKTSVSGNWIEIAYGTSSGAVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OLFML2B Pre-designed siRNA Set B
SI011047B 1 Each

Human OLFML2B Pre-designed siRNA Set B

Sign In for Pricing
View Details
Butyrylhydroxamic acid
HY-139122 1 Each

Butyrylhydroxamic acid

Sign In for Pricing
View Details
Recombinant Desulfatibacillum alkenivorans 3-deoxy-manno-octulosonate cytidylyltransferase (kdsB)
MBS1167959-01 0.02 mg (E-Coli)

Recombinant Desulfatibacillum alkenivorans 3-deoxy-manno-octulosonate cytidylyltransferase (kdsB)

Sign In for Pricing
View Details
Recombinant Desulfatibacillum alkenivorans 3-deoxy-manno-octulosonate cytidylyltransferase (kdsB)
MBS1167959-02 0.1 mg (E-Coli)

Recombinant Desulfatibacillum alkenivorans 3-deoxy-manno-octulosonate cytidylyltransferase (kdsB)

Sign In for Pricing
View Details
Recombinant Desulfatibacillum alkenivorans 3-deoxy-manno-octulosonate cytidylyltransferase (kdsB)
MBS1167959-03 0.02 mg (Yeast)

Recombinant Desulfatibacillum alkenivorans 3-deoxy-manno-octulosonate cytidylyltransferase (kdsB)

Sign In for Pricing
View Details
Recombinant Desulfatibacillum alkenivorans 3-deoxy-manno-octulosonate cytidylyltransferase (kdsB)
MBS1167959-04 0.1 mg (Yeast)

Recombinant Desulfatibacillum alkenivorans 3-deoxy-manno-octulosonate cytidylyltransferase (kdsB)

Sign In for Pricing
View Details