Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPACA1 Peptide - N-terminal region

SPACA1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC32952, SAMP32

UniProt

Q9HBV2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPACA1 Rabbit Polyclonal Antibody (orb580938) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112222

Preservative

Lyophilized powder

AA Sequence

TENNDSETAENYAPPETEDVSNRNVVKEVEFGMCTVTCGIGVREVILTNG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ET-745
TRC-E192830-25MG 25 mg

ET-745

Sign In for Pricing
View Details
Frozen Tissue Sections, Carotid body
CS644918 5x 5 µm

Frozen Tissue Sections, Carotid body

Sign In for Pricing
View Details
Recombinant Human PDCD10/TFAR15 Protein
PKSH032865-01 10 µg

Recombinant Human PDCD10/TFAR15 Protein

Sign In for Pricing
View Details
Recombinant Human PDCD10/TFAR15 Protein
PKSH032865-02 50 µg

Recombinant Human PDCD10/TFAR15 Protein

Sign In for Pricing
View Details
Human CRTC3 activation kit by CRISPRa
GA112145 1 Kit

Human CRTC3 activation kit by CRISPRa

Sign In for Pricing
View Details
BLOC1S3 Antibody
OC-662-01 50 μL

BLOC1S3 Antibody

Sign In for Pricing
View Details