Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STH Peptide - middle region

STH Peptide - middle region

Product Specifications

Product Name Alternative

MAPTIT, MGC163191, MGC163193

UniProt

Q8IWL8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STH Rabbit Polyclonal Antibody (orb326460) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007533

Preservative

Lyophilized powder

AA Sequence

SSSEVGLEGVGTIWPSSYSSEESSRNGAEQGRQLSIEGPFQGQNCPSHPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

14-3-3 θ/YWHAQ (phospho-S232) polyclonal antibody
BS64156-01 50 µL

14-3-3 θ/YWHAQ (phospho-S232) polyclonal antibody

Sign In for Pricing
View Details
14-3-3 θ/YWHAQ (phospho-S232) polyclonal antibody
BS64156-02 100 µL

14-3-3 θ/YWHAQ (phospho-S232) polyclonal antibody

Sign In for Pricing
View Details
Recombinant Human UBE2B Protein, His, E.coli-2ug
QP13853-2ug 2ug

Recombinant Human UBE2B Protein, His, E.coli-2ug

Sign In for Pricing
View Details
OR9M1P Protein Vector (Human) (pPM-C-HA)
PV109068 500 ng

OR9M1P Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Human Serine Protease ELISA Kit
MBS004954-01 48 Well

Human Serine Protease ELISA Kit

Sign In for Pricing
View Details
Human Serine Protease ELISA Kit
MBS004954-02 96 Well

Human Serine Protease ELISA Kit

Sign In for Pricing
View Details