Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GH1 Peptide - C-terminal region

GH1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GH, GH-N, GHN, IGHD1B, hGH-N

UniProt

P01241

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GH1 Rabbit Polyclonal Antibody (orb578203) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_072053

Preservative

Lyophilized powder

AA Sequence

SDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Zinc finger protein GLI2 (GLI2) ELISA Kit
GTR10329860 96 Well

Rabbit Zinc finger protein GLI2 (GLI2) ELISA Kit

Sign In for Pricing
View Details
NEU4, CT (NEU4, Sialidase-4, N-acetyl-alpha-neuraminidase 4) (AP)
MBS6324773-01 0.2 mL

NEU4, CT (NEU4, Sialidase-4, N-acetyl-alpha-neuraminidase 4) (AP)

Sign In for Pricing
View Details
NEU4, CT (NEU4, Sialidase-4, N-acetyl-alpha-neuraminidase 4) (AP)
MBS6324773-02 5x 0.2 mL

NEU4, CT (NEU4, Sialidase-4, N-acetyl-alpha-neuraminidase 4) (AP)

Sign In for Pricing
View Details
TCTN2 Rabbit pAb (APR21747N)
APR21747N-01 50 µL

TCTN2 Rabbit pAb (APR21747N)

Sign In for Pricing
View Details
TCTN2 Rabbit pAb (APR21747N)
APR21747N-02 100 µL

TCTN2 Rabbit pAb (APR21747N)

Sign In for Pricing
View Details
TCTN2 Rabbit pAb (APR21747N)
APR21747N-03 200 µL

TCTN2 Rabbit pAb (APR21747N)

Sign In for Pricing
View Details