Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCTN2 Rabbit pAb (APR21747N)

Product Specifications

Background

This gene encodes a type I membrane protein that belongs to the tectonic family. Studies in mice suggest that this protein may be involved in hedgehog signaling, and essential for ciliogenesis. Mutations in this gene are associated with Meckel syndrome type 8. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TCTN2 Rabbit pAb (APR21747N) .

Synonyms

TCTN2; C12orf38; JBTS24; MKS8; TECT2

Gene ID

79867

UniProt

Q96GX1

Cellular Locus

Cytoplasm, Membrane, Single-pass type I membrane protein, cilium basal body, cytoskeleton

Dilution

IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 76kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=79867

Uniprot URL

https://www.uniprot.org/uniprot/Q96GX1

AA Sequence

VKFLSYNSGNEEELSGNPGYQLGKPVRALNINRMNNVTTLHLWQSAGRGLCTSATFKPILFGENVLSGCLLEVGINENCTQLRENAVERLDSLIQATHVAMRGNSDYADLSDGWLEIIRVDAPDPGADPLASSVNGMCLDIPAHLSIRILISDAGAVEGITQQEILGVETRFSSVNWQYQCGLTCEHKADLLPISASVQFIKIPAQLPHPLTRFQINYTEYDCNRNEVCWPQLLYPWTQYYQGELHSQCVA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse monoclonal Adrenomedullin/ADM Antibody (OTI8A1)
NBP2-46497 0.1 mL

Mouse monoclonal Adrenomedullin/ADM Antibody (OTI8A1)

Sign In for Pricing
View Details
Recombinant Synechocystis sp. Cytochrome b6 (petB), partial
MBS7082462 Inquire

Recombinant Synechocystis sp. Cytochrome b6 (petB), partial

Sign In for Pricing
View Details
PLV3-CMV-KRAS-Neo Plasmid
PVT84029 2 µg

PLV3-CMV-KRAS-Neo Plasmid

Sign In for Pricing
View Details
Anti-Human CD66b/CEACAM8 Antibody (BW250/183)
HB202107 100 µg

Anti-Human CD66b/CEACAM8 Antibody (BW250/183)

Sign In for Pricing
View Details
Anti-Human ERBB4/Her4 Antibody (mAb1479), APC
FHH06113 100 Tests

Anti-Human ERBB4/Her4 Antibody (mAb1479), APC

Sign In for Pricing
View Details
MET Antibody
A41852-100UL 100 µL

MET Antibody

Sign In for Pricing
View Details