Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCBP3 Peptide - C-terminal region

NCBP3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ELG, C17orf85, HSA277841

UniProt

Q53F19

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_061023

Preservative

Lyophilized powder

AA Sequence

RLGSAPKTKEKNTKKVDHRAPGAEEDDSELQRAWGALIKEKEQSRQKKSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LZTFL1 Polyclonal Antibody
E-AB-15183-01 20 µL

LZTFL1 Polyclonal Antibody

Sign In for Pricing
View Details
LZTFL1 Polyclonal Antibody
E-AB-15183-02 60 µL

LZTFL1 Polyclonal Antibody

Sign In for Pricing
View Details
LZTFL1 Polyclonal Antibody
E-AB-15183-03 120 µL

LZTFL1 Polyclonal Antibody

Sign In for Pricing
View Details
LZTFL1 Polyclonal Antibody
E-AB-15183-04 200 µL

LZTFL1 Polyclonal Antibody

Sign In for Pricing
View Details
4-Nitrophenyl Phosphorodichloridate
TRC-N504535-5G 5 g

4-Nitrophenyl Phosphorodichloridate

Sign In for Pricing
View Details
Amino-Modifier C6 dT
6002-AAT 100 µmole

Amino-Modifier C6 dT

Sign In for Pricing
View Details