Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YAE1 Peptide - C-terminal region

YAE1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GK003, YAE1D1, C7orf36

UniProt

Q9NRH1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with YAE1 Rabbit Polyclonal Antibody (orb326796) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064577

Preservative

Lyophilized powder

AA Sequence

SHVVDLLDSIEDMDLCHVVPAEKKIDEAKDERLCENNAEFNKNCSKSHSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rala ORF Vector (Rat) (pORF)
38457016 1.0 µg DNA

Rala ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
TMEM79 Antibody (HRP)
orb516570-01 50 µg

TMEM79 Antibody (HRP)

Sign In for Pricing
View Details
TMEM79 Antibody (HRP)
orb516570-02 100 µg

TMEM79 Antibody (HRP)

Sign In for Pricing
View Details
PCDHGB5 shRNA Plasmid (h)
sc-106950-SH 20 µg

PCDHGB5 shRNA Plasmid (h)

Sign In for Pricing
View Details
Equine IL13 Protein
orb1477264-01 20 µg

Equine IL13 Protein

Sign In for Pricing
View Details
Equine IL13 Protein
orb1477264-02 100 µg

Equine IL13 Protein

Sign In for Pricing
View Details