Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Equine IL13 Protein

This Equine IL13 Protein spans the amino acid sequence from region 21-133aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

B6C802

Expression Region

21-133aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Equus caballus (Horse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APLPSSMALKELIKELVNITQNQAPLCNGSMVWSVNLTADTYCRALESLSNVSTCSAIQNTRKMLTKLCPHQLSAGQVSSERARDTKIEVIVLVKDLLKNLRKIFHGGKHVDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goose Total Adiponectin ELISA Kit
MBS010693 Inquire

Goose Total Adiponectin ELISA Kit

Sign In for Pricing
View Details
GcvP Antibody
orb816476 2 mg

GcvP Antibody

Sign In for Pricing
View Details
G-5555
S8139-5mg 5 mg

G-5555

Sign In for Pricing
View Details
C3orf37 (HMCES) (NM_020187) Human Untagged Clone
SC313096 10 µg

C3orf37 (HMCES) (NM_020187) Human Untagged Clone

Sign In for Pricing
View Details
RAGE/SERT-IN-1
MBS5815095 Inquire

RAGE/SERT-IN-1

Sign In for Pricing
View Details
Rat Arachidonic Acid (AA) ELISA Kit
MBS286766-01 48 Tests

Rat Arachidonic Acid (AA) ELISA Kit

Sign In for Pricing
View Details