Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mpp2 Peptide - C-terminal region

Mpp2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Dlg2

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mpp2 Rabbit Polyclonal Antibody (orb330873) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

G3V8T8

Preservative

Lyophilized powder

AA Sequence

ADLRRTVEESSRIQRGYGHYFDLSLVNSNLERTFRELQTAMEKLRTEPQW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Deubiquitinating enzyme ELISA Kit
MBS750098-01 48 Well

Bovine Deubiquitinating enzyme ELISA Kit

Sign In for Pricing
View Details
Bovine Deubiquitinating enzyme ELISA Kit
MBS750098-02 96 Well

Bovine Deubiquitinating enzyme ELISA Kit

Sign In for Pricing
View Details
Bovine Deubiquitinating enzyme ELISA Kit
MBS750098-03 5x 96 Well

Bovine Deubiquitinating enzyme ELISA Kit

Sign In for Pricing
View Details
Bovine Deubiquitinating enzyme ELISA Kit
MBS750098-04 10x 96 Well

Bovine Deubiquitinating enzyme ELISA Kit

Sign In for Pricing
View Details
Myrtucommulone A
HY-N7196 Inquire

Myrtucommulone A

Sign In for Pricing
View Details
[4- (Methylcarbamoyl) phenyl]methanesulfonyl chloride
AAC54164-01 50 mg

[4- (Methylcarbamoyl) phenyl]methanesulfonyl chloride

Sign In for Pricing
View Details