Idua Peptide - middle region
Idua Peptide - middle region
Product Specifications
UniProt
D6REH5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IDUA Rabbit Polyclonal Antibody (orb585719) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MENQLLPGFELMGSPSGYFTDFDDKQQVFEWKDLVSLLARRYIGRYGLTH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15310570 1 Vial
Lentiviral human ASB11 shRNA (UAS) - Lentiviral human ASB11 shRNA (UAS) plasmid
Sign In for Pricing
View Details 
MBS2103924-01 5x 96 Tests
Mouse Interleukin 18 Binding Protein (IL18BP) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details