Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lrrc14 Peptide - C-terminal region

Lrrc14 Peptide - C-terminal region

Product Specifications

UniProt

Q6VB43

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRC14 Rabbit Polyclonal Antibody (orb576974) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELRTVVHPFPVDCYEGLPWPPPASVLLEASINEEKFARVEAELHQLLLAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ING -1 AM - yellow -green fluorescent sodium indicator
2015F 10x 50 µg

ING -1 AM - yellow -green fluorescent sodium indicator

Sign In for Pricing
View Details
Carbonic Anhydrase I (CA1) (166-176) Goat Polyclonal Antibody
AP23069PU-N 50 µg

Carbonic Anhydrase I (CA1) (166-176) Goat Polyclonal Antibody

Sign In for Pricing
View Details
CF®594 Rabbit Anti-DNP, 2 mg/mL
#20868-250uL 1x 250 µL

CF®594 Rabbit Anti-DNP, 2 mg/mL

Sign In for Pricing
View Details
ROR alpha (RORA) (NM_134261) Human Over-expression Lysate
LC403350 20 µg

ROR alpha (RORA) (NM_134261) Human Over-expression Lysate

Sign In for Pricing
View Details
Usp51 Mouse Gene Knockout Kit (CRISPR)
KN518810 1 Kit

Usp51 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
USP9x Recombinant Rabbit Monoclonal Antibody [JG35-11]
ET7108-08 100 µL

USP9x Recombinant Rabbit Monoclonal Antibody [JG35-11]

Sign In for Pricing
View Details