Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGR Peptide - N-terminal region

PGR Peptide - N-terminal region

Product Specifications

Product Name Alternative

PR, NR3C3

UniProt

P06401

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PGR Rabbit Polyclonal Antibody (orb573692) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000917.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPRGLSPARQLLLPASESPHWSGAPVKPSPQAAAVEVEEEDGSESEESAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HEY1 Antibody
OAAL00602-100UG 100 µg

HEY1 Antibody

Sign In for Pricing
View Details
Monkey Long Palate, Lung and Nasal Epithelium Carcinoma Associated Protein 3 (SPLUNC3) ELISA Kit
MBS9349048-01 48 Well

Monkey Long Palate, Lung and Nasal Epithelium Carcinoma Associated Protein 3 (SPLUNC3) ELISA Kit

Sign In for Pricing
View Details
Monkey Long Palate, Lung and Nasal Epithelium Carcinoma Associated Protein 3 (SPLUNC3) ELISA Kit
MBS9349048-02 96 Well

Monkey Long Palate, Lung and Nasal Epithelium Carcinoma Associated Protein 3 (SPLUNC3) ELISA Kit

Sign In for Pricing
View Details
Monkey Long Palate, Lung and Nasal Epithelium Carcinoma Associated Protein 3 (SPLUNC3) ELISA Kit
MBS9349048-03 5x 96 Well

Monkey Long Palate, Lung and Nasal Epithelium Carcinoma Associated Protein 3 (SPLUNC3) ELISA Kit

Sign In for Pricing
View Details
Monkey Long Palate, Lung and Nasal Epithelium Carcinoma Associated Protein 3 (SPLUNC3) ELISA Kit
MBS9349048-04 10x 96 Well

Monkey Long Palate, Lung and Nasal Epithelium Carcinoma Associated Protein 3 (SPLUNC3) ELISA Kit

Sign In for Pricing
View Details
Anti-CD20 Aptamer-CTApt-530
CTApt-530 10 nmol

Anti-CD20 Aptamer-CTApt-530

Sign In for Pricing
View Details