Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HEY1 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Hes related family bHLH transcription factor with YRPW motif 1

Gene Aliases

Basic helix-loop-helix protein OAF1; BHLHb31; cardiovascular helix-loop-helix factor 2; CHF2; class B basic helix-loop-helix protein 31; hairy and enhancer of split-related protein 1; hairy/enhancer-of-split related with YRPW motif 1; hairy/enhancer-of-split related with YRPW motif protein 1; hairy-related transcription factor 1; HERP2; HESR1; HES-related repressor protein 1; HES-related repressor protein 2; hHRT1; HRT-1; NERP2; OAF1.

Gene ID

23462

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_036390

Reactivity

Human, Mouse

Immunogen

HEY1 (NP_036390, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene encodes a nuclear protein belonging to the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH) -type transcriptional repressors. Expression of this gene is induced by the Notch and c-Jun signal transduction pathways. Two similar and redundant genes in mouse are required for embryonic cardiovascular development, and are also implicated in neurogenesis and somitogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq

Clonality

Monoclonal

Clone

1B9

Type

Monoclonal Antibody

Sequence

DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLG

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

HEY1

Host or Source

Mouse

Protein Name

Hairy/enhancer-of-split related with YRPW motif protein 1 isoform a [Homo sapiens]|Homo sapiens hes related family bHLH transcription factor with YRPW motif 1 (HEY1), transcript variant 1, mRNA

Gene Name URL

HEY1

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_012258

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAGE2 siRNA (Human)
CRJ6349-01 15 nmol

PAGE2 siRNA (Human)

Sign In for Pricing
View Details
PAGE2 siRNA (Human)
CRJ6349-02 30 nmol

PAGE2 siRNA (Human)

Sign In for Pricing
View Details
Goat Apolipoprotein L2 (APOL2) ELISA Kit
GTR10362958 96 Well

Goat Apolipoprotein L2 (APOL2) ELISA Kit

Sign In for Pricing
View Details
Sema3a-set siRNA/shRNA/RNAi Lentivector (Rat)
43342096 4x 500 ng

Sema3a-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Dram2 sgRNA CRISPR Lentivector set (Rat)
K7391101 3x 1.0 µg

Dram2 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
IL23R (IL-23R, IL-23 Receptor, IL-23 Receptor) (PE)
128452-PE 100 µL

IL23R (IL-23R, IL-23 Receptor, IL-23 Receptor) (PE)

Sign In for Pricing
View Details