Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EYA1 Peptide - N-terminal region

EYA1 Peptide - N-terminal region

Product Specifications

UniProt

E5RIQ7

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EYA1 Rabbit Polyclonal Antibody (orb329657) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QDLTSPHSRLSGSSESPSGPKLGNSHINSNSMTPNGTEVKTEPMSSSETA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cck Rat Pre-designed siRNA Set A
HY-RS22965 1 Set

Cck Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
SLC25A46 Polyclonal Antibody
ANT-14425-100ug 100 µg

SLC25A46 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Murine Interleukin-22
orb1906197-01 10 µg

Recombinant Murine Interleukin-22

Sign In for Pricing
View Details
Recombinant Murine Interleukin-22
orb1906197-02 100 µg

Recombinant Murine Interleukin-22

Sign In for Pricing
View Details
Recombinant Murine Interleukin-22
orb1906197-03 500 µg

Recombinant Murine Interleukin-22

Sign In for Pricing
View Details
Histone H3.1 / HIST1H3A (H3C1) Antibody
abx343374-01 20 µL

Histone H3.1 / HIST1H3A (H3C1) Antibody

Sign In for Pricing
View Details