Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDZD3 Peptide - C-terminal region

PDZD3 Peptide - C-terminal region

Product Specifications

UniProt

Q86UT5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDZD3 Rabbit Polyclonal Antibody (orb587702) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: APLAEGWALPTKPRCLHLEKGPQGFGFLLREEKGLDGRPGQFLWEVDPGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagen α-2 (IV) chain (COL4a2) Mouse ELISA Kit
C5164 96 Tests

Collagen α-2 (IV) chain (COL4a2) Mouse ELISA Kit

Sign In for Pricing
View Details
Dnmt1 (BC053047) Mouse Tagged ORF Clone
MR212057 10 µg

Dnmt1 (BC053047) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
PTPA Peptide - middle region
orb1998746 100 µg

PTPA Peptide - middle region

Sign In for Pricing
View Details
Human C12orf76 (NM_207435) AAV Particle
RC223596A1V 250 µL

Human C12orf76 (NM_207435) AAV Particle

Sign In for Pricing
View Details
pCDNA3.1-3XFLAG-ATG5 Plasmid
PVT31935 2 µg

pCDNA3.1-3XFLAG-ATG5 Plasmid

Sign In for Pricing
View Details
Myh3 3'UTR GFP Stable Cell Line
TU163705 1.0 mL

Myh3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details