What is the catalog number for PTPA Peptide - middle region?

The catalog number for PTPA Peptide - middle region is orb1998746.

What sizes are available for PTPA Peptide - middle region?

PTPA Peptide - middle region is available in the following size(s): 100 µg.

Is PTPA Peptide - middle region in stock?

PTPA Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

PTPA Peptide - middle region

Product Specifications

Product Name Alternative

PP2A, PR53, PPP2R4

UniProt

Q15257

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001180326.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PC501864 1 Each

2-Bromo-3,5-difluorophenacyl bromide

Sign In for Pricing

View Details

AAA78902-01 10 mg

2,4'-Dichlorodiphenyltrichloroethane

Sign In for Pricing

View Details

AAA78902-02 25 mg

2,4'-Dichlorodiphenyltrichloroethane

Sign In for Pricing

View Details

AAA78902-03 50 mg

2,4'-Dichlorodiphenyltrichloroethane

Sign In for Pricing

View Details

19536101 1 µg

ETV5-AS1 AAV Vector (Human) (CMV)

Sign In for Pricing

View Details

TRV-0021336-01 24 Tests

Rapid ELISA Kit for Mucin 5 Subtype AC (MUC5AC)

Sign In for Pricing

View Details