Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBBX Peptide - N-terminal region

ZBBX Peptide - N-terminal region

Product Specifications

UniProt

F2Z370

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZBBX Rabbit Polyclonal Antibody (orb587805) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001186131

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QNKGNVVKFSAGKVKLKLLKEQIQEPVKPTVNYKMANSSECEKPKINGKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse NPHP4 (KIAA0673), Rabbit Polyclonal
MKA0673AF Inquire

Anti-Mouse NPHP4 (KIAA0673), Rabbit Polyclonal

Sign In for Pricing
View Details
DELGEF Recombinant Protein Antigen
NBP1-88025PEP 0.1 mL

DELGEF Recombinant Protein Antigen

Sign In for Pricing
View Details
C1orf163 3'UTR Luciferase Stable Cell Line
TU002101 1.0 mL

C1orf163 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human MMP-25/MT6-MMP MAb (Clone 141811)
MAB11422 500 µg

Human MMP-25/MT6-MMP MAb (Clone 141811)

Sign In for Pricing
View Details
ZCCHC12, CT (ZCCHC12, SIZN1, Zinc finger CCHC domain-containing protein 12, Smad-interacting zinc finger protein 1) (MaxLight 405) discontinued
044027-ML405 100 µL

ZCCHC12, CT (ZCCHC12, SIZN1, Zinc finger CCHC domain-containing protein 12, Smad-interacting zinc finger protein 1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Fzd5 Knockout CAL27 Polyclonal Cells
ARG11528 1 Million

Fzd5 Knockout CAL27 Polyclonal Cells

Sign In for Pricing
View Details