Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBBX Peptide - N-terminal region

ZBBX Peptide - N-terminal region

Product Specifications

UniProt

F2Z370

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZBBX Rabbit Polyclonal Antibody (orb587805) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001186131

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QNKGNVVKFSAGKVKLKLLKEQIQEPVKPTVNYKMANSSECEKPKINGKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HEY1 (Hairy/Enhancer-of-Split Related with YRPW Motif 1, BHLHb31, CHF2, HERP2, HESR1, HRT-1, MGC1274, OAF1) (AP)
MBS6163099-01 0.1 mL

HEY1 (Hairy/Enhancer-of-Split Related with YRPW Motif 1, BHLHb31, CHF2, HERP2, HESR1, HRT-1, MGC1274, OAF1) (AP)

Sign In for Pricing
View Details
HEY1 (Hairy/Enhancer-of-Split Related with YRPW Motif 1, BHLHb31, CHF2, HERP2, HESR1, HRT-1, MGC1274, OAF1) (AP)
MBS6163099-02 5x 0.1 mL

HEY1 (Hairy/Enhancer-of-Split Related with YRPW Motif 1, BHLHb31, CHF2, HERP2, HESR1, HRT-1, MGC1274, OAF1) (AP)

Sign In for Pricing
View Details
TCC52 Antibody
MBS9410556-01 0.1 mL

TCC52 Antibody

Sign In for Pricing
View Details
TCC52 Antibody
MBS9410556-02 5x 0.1 mL

TCC52 Antibody

Sign In for Pricing
View Details
Ndrg3 Rat shRNA Lentiviral Particle (Locus ID 296318)
TL702060V 500 µL Each

Ndrg3 Rat shRNA Lentiviral Particle (Locus ID 296318)

Sign In for Pricing
View Details
C16orf92 (NM_001109659) Human Over-expression Lysate
LS146378-20ug 20 µg

C16orf92 (NM_001109659) Human Over-expression Lysate

Sign In for Pricing
View Details