Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBBX Peptide - N-terminal region

ZBBX Peptide - N-terminal region

Product Specifications

UniProt

F2Z370

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZBBX Rabbit Polyclonal Antibody (orb587805) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001186131

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QNKGNVVKFSAGKVKLKLLKEQIQEPVKPTVNYKMANSSECEKPKINGKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPCN1 (NM_001143819) Human Over-expression Lysate
LS053373 100 µg

TPCN1 (NM_001143819) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Monoclonal HLA ABC Antibody (MHC-I/8147R) [Alexa Fluor 647]
NBP3-20852AF647 0.1 mL

Rabbit Monoclonal HLA ABC Antibody (MHC-I/8147R) [Alexa Fluor 647]

Sign In for Pricing
View Details
Anti-FAM40B/STRIP2 Antibody Picoband®
A12139 100 µg/Vial

Anti-FAM40B/STRIP2 Antibody Picoband®

Sign In for Pricing
View Details
5430421N21Rik sgRNA CRISPR Lentivector set (Mouse)
K3062601 3x 1.0 µg

5430421N21Rik sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
group II sPLA2 HDR Plasmid (m)
sc-422281-HDR 20 µg

group II sPLA2 HDR Plasmid (m)

Sign In for Pricing
View Details
NIPA1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-19250R-BF750 100 µL

NIPA1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details