Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5B3 Peptide - C-terminal region

OR5B3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-239, OR5B13, OST129

UniProt

Q8NH48

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR5B3 Rabbit Polyclonal Antibody (orb587610) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005469

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSSHSMDTDKMAPVFYTMVIPMLNPLVYSLRNKEVKSAFKKVVEKAKLSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzyl- (2,2,2-trifluoro-ethyl) -amine
sc-326235 500 mg

Benzyl- (2,2,2-trifluoro-ethyl) -amine

Sign In for Pricing
View Details
FLJ25444 Protein Vector (Human) (pPB-C-His)
PV052213 500 ng

FLJ25444 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
NAT9 Peptide - C-terminal region
orb2003490 100 µg

NAT9 Peptide - C-terminal region

Sign In for Pricing
View Details
D-Glucoheptonic Acid Sodium Salt Dihydrate
293492-01 250 g

D-Glucoheptonic Acid Sodium Salt Dihydrate

Sign In for Pricing
View Details
D-Glucoheptonic Acid Sodium Salt Dihydrate
293492-02 1 Kg

D-Glucoheptonic Acid Sodium Salt Dihydrate

Sign In for Pricing
View Details
D-Glucoheptonic Acid Sodium Salt Dihydrate
293492-03 5 Kg

D-Glucoheptonic Acid Sodium Salt Dihydrate

Sign In for Pricing
View Details