NAT9 Peptide - C-terminal region
NAT9 Peptide - C-terminal region
Product Specifications
UniProt
Q9BTE0
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NAT9 Rabbit Polyclonal Antibody (orb580520) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KLHFEQVATSSVFQEVTLRLTVSESEHQWLLEQTSHVEEKPYRDGSAEPC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![DC SIGN (CD209) Mouse Monoclonal Antibody [Clone ID: UW60.1]](https://cdn.genprice.uk/products/937/68dd189c061270361e8fcbc7/imageurl/am26379ac-n.webp)
AM26379AC-N 100 Tests
DC SIGN (CD209) Mouse Monoclonal Antibody [Clone ID: UW60.1]
Sign In for Pricing
View Details 
BNC040970-500 1x 500 µL
GLG1 (Golgi Complex) (GLG1/970), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041076-100 1x 100 µL
Cytokeratin, HMW (KRTH/1076), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details