Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIP1 Peptide - C-terminal region

HIP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HIP1

UniProt

O00291

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HIP1 Rabbit Polyclonal Antibody (orb585707) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005329

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IVESGRGTASPKEFYAKNSRWTEGLISASKAVGWGATVMVDAADLVVQGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTBP2, NT (CTBP2, C-terminal-binding protein 2) (AP) discontinued
034322-AP 200 µL

CTBP2, NT (CTBP2, C-terminal-binding protein 2) (AP) discontinued

Sign In for Pricing
View Details
Human Alpha-Fetoprotein (aFP) ELISA Kit
RDR-aFP-Hu-96Tests 96 Tests

Human Alpha-Fetoprotein (aFP) ELISA Kit

Sign In for Pricing
View Details
PAGE4 Antibody
OAAL00459-100UG 100 µg

PAGE4 Antibody

Sign In for Pricing
View Details
Phospho-TERT (Ser1125) Rabbit pAb, BF700 conjugated
orb2861245 100 µL

Phospho-TERT (Ser1125) Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
GENLISA™ Rat Cyclooxygenase 1 (COX-1) ELISA
KLR1245 1x 96 Well

GENLISA™ Rat Cyclooxygenase 1 (COX-1) ELISA

Sign In for Pricing
View Details
Ablim2 Mouse shRNA Plasmid (Locus ID 231148)
TL506922 1 Kit

Ablim2 Mouse shRNA Plasmid (Locus ID 231148)

Sign In for Pricing
View Details