Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAGE4 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

PAGE family member 4

Gene Aliases

CT16.7; g antigen family C member 1; GAGE-9; GAGEC1; JM27; JM-27; P antigen family member 4; P antigen family, member 4 (prostate associated) ; PAGE-1; PAGE-4; prostate-associated gene protein 4.

Gene ID

9506

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_008934.1

Reactivity

Human, Mouse

Immunogen

PAGE4 (NP_008934.1, 1 a.a. ~ 102 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer, but is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer. The protein encoded by this gene shares sequence similarity with other GAGE/PAGE proteins, and also belongs to a family of CT (cancer-testis) antigens. [provided by RefSeq

Clonality

Monoclonal

Clone

7C3

Type

Monoclonal Antibody

Sequence

MSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2b Kappa

NCBI Gene Symbol

PAGE4

Host or Source

Mouse

Protein Name

Homo sapiens PAGE family member 4 (PAGE4), transcript variant 1, mRNA|P antigen family member 4 [Homo sapiens]

Gene Name URL

PAGE4

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_007003.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC-Linked Polyclonal Antibody to Anoctamin 6 (ANO6)
MBS2077218-01 0.1 mL

FITC-Linked Polyclonal Antibody to Anoctamin 6 (ANO6)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Anoctamin 6 (ANO6)
MBS2077218-02 0.2 mL

FITC-Linked Polyclonal Antibody to Anoctamin 6 (ANO6)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Anoctamin 6 (ANO6)
MBS2077218-03 0.5 mL

FITC-Linked Polyclonal Antibody to Anoctamin 6 (ANO6)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Anoctamin 6 (ANO6)
MBS2077218-04 1 mL

FITC-Linked Polyclonal Antibody to Anoctamin 6 (ANO6)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Anoctamin 6 (ANO6)
MBS2077218-05 5 mL

FITC-Linked Polyclonal Antibody to Anoctamin 6 (ANO6)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Anoctamin 6 (ANO6)
MBS2077218-06 5x 5 mL

FITC-Linked Polyclonal Antibody to Anoctamin 6 (ANO6)

Sign In for Pricing
View Details